dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|319760305|ref|YP_004124243.1| (Candidatus Blochmannia vafer str. BVAF)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment siroheme synthase [Candidatus Blochmannia vafer str. BVAF]
Sequence length 465
Sequence
MKYLPLFINFNKKSILVVGGGIVAFRKIQILRKSGAIINIVARVLCPNLKKILFLEKIIW
IGKTFQPSMLDGIFLIIISTNNIFLNNVIFKHAEKRRILINTVDNKSTCSCIFPAIIDRS
PIIIGISSFGTAPVLIRILREKLESLIPASIGYLAELAGTWRDRVKRYIKNISCRRQFWE
NLFYSGRILFLIEQGKIDQANKIIQNTIKLNKLNIKKKGSVALVGAGPGDKELLTIRGLQ
LMQQADIILYDNLVNPDILDLARRDADKIYVGKSANKHSISQDRLNNFMIQLAQKGNDIV
RLKGGDSFIFGRGGEELLAISKAGIEFQVVPGITAAIGVAAYSGIPLTHRKYAHSVVFIT
GHEQCNNDYYQINWKSLSDKYQTIVIYMGKLNILNISKNLICNGRHINTPVAIISRGTYK
DQKILIGTLIELEKLVLTAKQPVLLIVGEVVSLHDKISWFGSNKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]