dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

JGI_V11_88832 (Bigelowiella natans CCMP2755 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000320545.1:scaffold_39:85694:92336:-1 gene:estExt_fgenesh1_pg.C_390017 transcript:JGI_V11_88832 description:""
Sequence length 809
Sequence
MPETEQGMKLAWMPIDGAVAMLMTRHQVTNPGPKTVSDVARSLTGEQKVFQGHVFVRFAQ
GAPALMLLQCEESGSVVTPPQGSTTGLEFEGHTTGIVPFIEIATWKSAPMSELPKDTEEI
AFCSPGHAPNEHRERQATFHQWVICISPYVVCKSLSKFVMRESVMFNVVERKQERRKREQ
KRDKENSCIAPSIDLHLGCTESRTTTKPLVSVGNDKKAVGDIAAKFIIEEAKKAIASTGR
FTVAFSGGSLPKIVGPALVEKKVEDTDKWFVFFSDERCVKLSSDDSNYKSVREFVLDPLK
IPKKNVVTIDPNQYEDAEKAAKLYEESVAGFFKDSSSSTPVFDLILLGMGPDGHTCSLFP
KHKLLAETKANIAPITDSPKPPSNRITFTYPVLDAAKAVAFVCCGGGKSGALKTVIEGSE
TPDDQLPSGRIKNKRRNTDQTYYITIDPEICCCRVKRRIYAIQNLVVKQATHNSLSFSTP
QSPRFFRWGALGLSGGGLKRKANGGQIISAGRAYVVDNFCEARRQWRRRQLQVIHDSGYE
DVEVYPLPTRLRDGDERVCARVQIVTGTCKQPEKEISGLVKIVHKDEAIGKVKVTNRRKR
KPTDAFDPLIPGSDLVYHRVVADIVLKNDTEDGEVKYKIELSRKWEGAALRLRMLERIMN
KYPTTSIVISLNNTQVQIWQLLRLAALSANRDISVGHITGINSEWTPIDLKVNSSLSFPR
PQGVFLPKNCEYSLTVRMAPEASHTYKRMRRLLTPFRDPPGKIFSIGKSGQHQQRSDQAG
TGDLENKSEATSSSRRRRRAKRERLKNRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]