dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

psu|LbrM34_V2.1080 (Leishmania braziliensis MHOM/BR/75/M2904 2.4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr34:437942-439747(+) | length=601
Sequence length 601
Sequence
MLRTGAATASSAVVSSRDVRQRSQGLPRRQVDMHVREKMKWPIAVLSSVEALALLVQGSF
QRWCNVGSDSTRHGIRRFRLSTSSLHRSHLRCSKACLSTGIKGKTPNTDLQGVSGSATDL
RLSVEEELHHPRENVGAFADSSSFRDGEHPSEGVATGAAPLASSSPVPNEAVASIIAEVK
SNAAIFDVNGDGSGADTAPEWTEPTLADLDRSIPQVDCEFMASLIRSRNLRRGVFLTKKE
VVKQRVEELTKKTTRTVNETVRLPFVGGLGLGWFSKPKGGDVVKGEESGLVATSTEAPVL
ASAAVLKKLSVEEKDLLHSTRPEYDDGFVLLDCRTVNEVTSWGIIEGAKVLPAHELFEAF
HATPEEFMEDYGFAKPRPDDIIICYCQYGPRSLMAAQILSWMGYLKVMHFRDGYYEWGKQ
YNLLLRRWMEHDKESGNELRRLATFRAGLELQREIAPEFNALPMQEARQYLRDTTRSPGT
LIVGEGLRLEAYKLVAKLTEGLAPPSLPGVLDDDSSIALTGSRCTAESKTTQTRRLGEQQ
LTRFLEQTTGLDPKKELSRSALSMNMGEAQAMVLDSLAYGHDLGASPDAKTSPMSPPPRR
N

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]