dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CPAG_04193.1 (Candida parapsilosis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | CPAG_04193 | Candida parapsilosis CPAG_04193 (597 aa)
Sequence length 596
Sequence
MTSPVYATTTTTTTTTTTTTIISSILSSSPSGASSQSWEIIQNTIAQNVLYLLNLLEVLP
GGQIIVRYIKSSYQNDPVRSLFEYCLFIFALTYFFTSKKKENKSEFVKFTPREIDELCDE
WVPETLVEPVTDLEAWKIKAIPEVKGFNGSHIELINPSFKEICHDSSIVNLVKQDFLDLN
SNANIKQVAKTEIQFAGVGACGPPNFYGTQDVHVRLEEDLARYLGTDQAIIYGQDFVTAS
SVLPAYLKRGDLCVVDRNVNLAIQKALIVSRVDLEWYDHNDMEHLEQILTQLKPILDKQK
PLRRRFIITEGLFANTGDLANLPTIVELKNKFKYRLFLDESLSIGVLGNTGKGLTEHYGI
SRDEIAITIGSMANSFASSGGFCVGVEPMIHHQRISSNAYVFSASLPPYSAKVTSQAIKE
INIVEPKTGKSKLMTQLHQRTIFAHDALLSSLKDVPMTITSVPQSPMIHLAFTELYRSQL
NLPLLYGNSIFVTKGKPAKFLNPFDEYLNLESFMLQKIIDYVLKHGKILLTRSKLILEHE
DLPVLPPQLLVNINAGVSEEELQRLAEVLPTAIDEVVSTVTNEDELFELTNELINY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]