dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CIMG_09272T0 (Coccidioides immitis RS )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | CIMG_09272 | Coccidioides immitis RS translation initiation factor eif-2b delta subunit (685 aa)
Sequence length 684
Sequence
MAPISGTQILWLLSILLIFYFSLPAFLQKKLAFRMTESTKKNGFGRATVALSRRCLRWPR
RKLMGIFRSKKSRPPRAPHMTQYAVQHHRHHATTAEENSNGNIAVDKEILRTDAIMWAPQ
GVVNSGVPQLSGGESSTKKGDRTSAAATSGSPSAAMNGGVEKKKDEEKGVDGKQTTEKKD
KPEGAANAPKLSNAELKKRAKAEKAARRAKEKQEREQQAGPAAQSQAGQQPAGPKKGDNK
QSQKKGEGQKAQKQGAGAAVVAQRRGSVHVPAAEAKKKKKKAENENIVAVFGHLPWHSRR
AGIAGVGKEIHPAVVALGMQLRDYVICGSSARCVATLLALRRVVQAYITPIGTSLSRNLT
TYLSHQINYLTTCRPLAISQGNAIRALKLEITTIDPGDSEDEAKQQIYDYIDNYIREKYT
VASQVIANSAAEKIKDGDVILCYANSSVVQKALLTAHAQGKKFRVFIVDTRPLFEGKNLA
RTLSKAGLEVQYSLINGIAYAIREATKVFLGAHAMTSNGCLFSRVGTALVAMSAKERVGG
IDIPVIVCCETAKFTDRVALDSIVVNEIAEADDLVGIEPSEQVTQLSPPTPAPTRKGGST
KSAGANADTSSLASSLGPTSLVTDHNRPLQNWRDMKHLQLLNIMHDVTPAQYIDMVITEM
GSLPPSAVPIVHRMSTESEDSKHY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]