dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CIMG_11906T0 (Coccidioides immitis RS )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | CIMG_11906 | Coccidioides immitis RS translation regulator GCD7 (453 aa)
Sequence length 452
Sequence
MAAPAILPMTPSLSSYIQSLKQSSVEASTENLITLLKRRHIRQPHSCALATAHLLLRAMH
TNKSNDPATLIDHVKRIGRRLVSAQPRQLIVGNIVRRVLGMMRDEAESWKRDCGMMSDAG
SDDTRPHTPPHGGFHNLARLPTHPGGALEKLSHLDSLERPSFTGHVTAAPALPGTSMFNL
LSYPPESTDPNSPISVSRGEPDTSDDKPRDYRGEVFDGIKEILEELNQANDQIAAYALDH
IHSNEVILTHTASTTVQKFLLKAAAKRKFSVIQVESYPNNHDDTHATVTGIRSGDEERLT
PEAFQKPLIAQGITVILIPDSAVFALMSQVNKVILGTDCVLANGGLVAAAGTRLIANAAK
AHKTPVVVVSGVYKLSPVYPFDQQSLVEYGDPSAVLPYEDGELVDNIDVVNPLSDYVPAE
LIDLYITNIGGHAPSYLYRIVADHYRNEDVKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]