dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSDORP00000011480 (Dipodomys ordii 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2136:68586:85073:-1 gene:ENSDORG00000012210 transcript:ENSDORT00000012209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 487
Sequence
MAGTKDLLMLENFIGGQFLPCHSYIDSYDPSTGEVYCKVPNSGKDEVEVAVEAARGAFPG
WSSQSPEKRAQVLNRLADLLEQSLEELAQAESKDQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRIFVQKSIY
CEFLKRFVEATRKWKVGIPSDPSASMGALISKPHLEKVRSYVKKARAEGAQILCGEGVDM
LSLPPKNQAGYFMLPTVITDIKDESCCMKEEIFGPVTCVVPFESEEEVIKRANSVEYGLA
ATVWSSNVGRIHRVAKKLQSGLIWTNCWLIRELNLPFGGMKHSGIGREGAKDSYDFFTEI
KTITVKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]