dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSMICP00000010200 (Microcebus murinus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2072:523613:830855:1 gene:ENSMICG00000011188 transcript:ENSMICT00000011200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 951
Sequence
MPRVLAPLVLLPVWLVMVACSPHSLRIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDSEYETAETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHFK
VPEFVKFQFQRFTTLNLHPSNDISVVAILNFFNCTTACLICAKAECLLNLEKLLRQFLIS
KDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYYTYIF
TNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFSQSLNQSWQENCDHAPFTGPAXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVELEGLTGHIEF
NSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDSLFNTTLVVTTILE
NPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGM
VGELIARKADLAVAGLTITAEREKVIDFSKPXXXXXXXXXXXXXXGRKPGYFSFLDPFSP
GVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFM
QQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAI
EYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLEST
MNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWE
GGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTATLSNGKLCGAGEPDQLAQRL
SQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLDWEKTTNSSEPE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]