dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CAWT_01484 (Candida albicans WO-1 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | CAWG_01484 | Candida albicans WO1 conserved hypothetical protein (999 aa)
Sequence length 998
Sequence
MASPYGIPNKSTGNDNSETFDFGGRSYVSMSYKPSLLSSSLVNTGVEVHEQTANLASVLV
TESLNEDENEDDLEQQQQQQHHREEESQDHQHSLSESSLLMPNSPRNNYFSQADALESEI
GSPSVNSFGRRSHSGSNPSVNSLPQPSPSSLSLSPKDNIPEKQPSKLHSYLVKPIRYIPG
VFLGTLLNILDGLSYGMIMFPISESIFASLAPAGLSMFYMSCIISQLIYSLGGSAFKAGI
GSEMIEVTPFFHTMAGAIAKQMTNESNGNNNINNDAIIATTITSYAVSSIVTGLVFFLLG
KLKLGVLVGFFPRHILVGCIGGVGYFLIATGIEVSSRLEGGLSYNYETFKYLFYNHTTLL
EWTIPLLLALILIILQHKYHNSLLVPLYFIAVFIIFHLSVAVVPSWNLNNARINGWIFPM
VEDNEPWYSFYSLYKFNLVDWVCIVRQIPTMLALTFFGILHVPINVPALAVSVGMDQVDV
DRELVAHGYSNAISGLVGSIQNYLVYTNSVLFIRAGADDRVAGVMLAIATAAVMMVGPVV
IGYIPVCVVGALIYLLGYELLKEAIYDTWGRLRNIEYITIIIIVVTMGAVDFVAGIGVGI
LLACLSFVVEAGRTPVVQGIYSGSVARSTVMRHPKQQEFLKNVGEQICIVKLQGTLFFGS
IGGVEKEIRNMFEHDKFKSNPIKYLIIDMKGVISLDFSAAEGFRRILNLANDFKTQFIIS
SVGEDDDIIQGLRDAGIFDNGANAPIELFSSLNYALEWCENSFLKTYSKLKKSDPVKTRS
VPGSSTLTTTRQSFASPSSYGAKIFGKYGEFGTPRTNQVFQAASKTVYDEHKTESKFESQ
KNSLFQKQPLSLIMLSFQGLSDKDAEFWSNITPYFVKEKIPENYQFYDTKNDEPAFFIVE
SGLIRSIIKFESEGRELHSSILPLVAFGDLDDASEYRQIIYTTVNDTVVWKLTQAKLKEM
LAKLGSKGEELYHELLEVEAKLIRGRFDTMTANLIIAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]