dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|188586158|ref|YP_001917703.1| (Natranaerobius thermophilus JW/NM-WN-LF)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M28 [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence length 571
Sequence
MRFTVESSLSITKLFFILLIAVLITVKLTGCGDHGYMVFLNLEPEEAGEVSGSGTYEQGE
EITVSVDTGESWEFIGWFEDGEKVSKEQEYTFSVTESRNLVAEMKPGEGEVIQGYIEDLL
EIGPRPPGSEAEKEAALFLKDVYRDLGYDEEGYELELQEFKLSEQTGFEDLKGPENMKLA
DISVMDGEEHFGNVSAELADQSWTYEKYHDTVWQAMTSPHGETASVEGEMYYSGTGMEEG
DFPEEVDGNIALIKVDDTEVEWEFNEDLNLRTFEISEQQIENAKEAGAEAVIFTFLDDEH
HQGNTEAQTMVPLIQDKEGKEKEVNIPILGASSIHGQWLQEMEKEHANPPELEISSYKNI
DLKSYNVVATKKSDKEDAPIITVTAHLDSVPGSPGASDNASGTTTLLKLAESLKNKDLDA
ELRFANLGAEEVGLFGAYHYVEQLSEEELENHYNINPDMIGTSYPKNDELFITSLDQSEN
EVTNSLLEGQEILDYDVATFDAQVNINSDHVAFDDKGIPAVCLVWMGERGLEPVYHTPLD
TVEDNISAKRLNLAYDIIKEGIIQLDERIQD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]