dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|218531374|ref|YP_002422190.1| (Methylobacterium chloromethanicum CM4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment threonine aldolase [Methylobacterium extorquens CM4]
Sequence length 346
Sequence
MAEQQFASDNYAGICPEALTAMQAANAGHAPAYGADTWTQAAADGFRRLFETDCEVFFVF
NGTAANSLALASLCQSYHSVICADSAHIETDECGAPEFFSNGSKLLTAATDDGKLTPEIV
RTIAGKRSDIHFPKPRAVTLTQATETGRVYSLDEIAAISAVCRALGLRLHMDGARFANAC
ASLDASPAELTWKAGVDVLCFGGTKNGMAVGEAVIFFDRKLAEDFDYRCKQAGQLASKMR
YLSAPWVGMLENGAWLDNARHANECARRLVRGIADVPGISLAAPVEANGVFLNLPAPVQE
GLRARGWQFYGFIGGASRFMFAWDSEPARVDALAQDIRLCALPAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]