dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|307595745|ref|YP_003902062.1| (Vulcanisaeta distributa DSM 14429)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment acyl-CoA dehydrogenase domain-containing protein [Vulcanisaeta distributa DSM 14429]
Sequence length 387
Sequence
MPDPFLTDEHQLIRNSVKEFAERYIVPIARKMDLEDYYPRDLIRELGKQGFLTPSAPPEY
GGPGIDLRGSVVVVEELSRYSPTLGFITEIVNDNIVYALLKYGSNKQKEEILPKIASGEW
VASYALTEPCCGTDAAAIETRAERRGGEWVINGRKIWITQGAYADIYLLFARTGPKEARH
RAITAFLVRRGDCVEVSKLEMMGMRGAGEAEVKFNDCVVGDDDVLGKINEGFKIAMVTLD
LARIGISGVAVGLSQGVLDEALEWAKTRTAFGKPLIDWEWIQFQLADMKAKLEIGRTVTY
KAAWLYDNKDPSFILYASIAKLYTAQMAVEIARDGVQILGGFGYSKESFSERAYRDAKVL
EIAEGTNEAQRIVIHRILARGLPEVEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]