dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|340618741|ref|YP_004737194.1| (Zobellia galactanivorans)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment prolyl-tRNA synthetase [Zobellia galactanivorans]
Sequence length 491
Sequence
MGKNLTKRSEDYSKWYNELVVKADLAENSGVRGCMVIKPYGFAIWEKMQAALDKMFKETG
HENAYFPLFIPKSYLSKEASHVEGFAKECAVVTHYRLKNAEDGSGIIVDPDAKLEEELIV
RPTSETIIWDTYRRWIQSYRDLPLLINQWANVVRWEMRTRLFLRTAEFLWQEGHTAHATE
AEAIEEAEKMMRVYAEFAEEHMAMPVIQGVKTESERFAGAIETYCIEALMQDGKALQAGT
SHFLGQNFAKAFDVKFANKEGKQEHVWATSWGVSTRLVGALIMSHSDDNGLVLPPKLAPI
QVVIVPIYKGMEQLDAISEKVAPLVKELRAKGISVKFDNRDTHKPGFKFNEYELKGVPVR
LAIGKRDLENGTYEVARRDTLTKEIVPMDDVVAKIEFLLEDIQKNIYQKAHSFREDNITE
VDTYEEFKKVLEEKGGFISAHWDGTNETEEKIKEETKATIRCIPLGTENKEGKCMVTGKL
SSKRVLFAKAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]