dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|340618755|ref|YP_004737208.1| (Zobellia galactanivorans)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L11 methyltransferase [Zobellia galactanivorans]
Sequence length 278
Sequence
MSNTIYIEYNFSVSPLQPGSDILIAELGEAGFESFVENEEGVLAYIQKEDWNENILETVE
ILDNSIFEVGFSIKEIEQENWNATWEKNFEAIQVADQCVVRAPFHEKPDVAFDIVIEPKM
SFGTGHHETTYMMLQFVLENDFEGKDVLDMGSGTGVLAILAALKKAAHIDAIDIDNWCYL
NAKENVERNNCSHISVFEGDSSLLGERKYNVILANINRNILLADIPVYAQNLRENGALFL
SGFYEEDIPLISETCLKAGLKFEKNLQKNNWVAVKYVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]