dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|340620530|ref|YP_004738983.1| (Zobellia galactanivorans)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment S-adenosylmethionine-dependent O-methyltransferase [Zobellia galactanivorans]
Sequence length 193
Sequence
MLDSQISDQPKIYQEIQRKSKEVGFTMPSDLYVGSLLKTLMLSKPNGRFLEMGTGIGLSL
SWMIDGMGPDSSLVSVDNDSDLIEIVSEYFGADERVELICQDGSDWIRSYEGGHFDLIFA
DAWPGKYSEIDETLRLLAIGGFYVVDDMAVQPNWPEGHEDNVGRLIGYLEGRDDFVLTKL
DWSTGLIVAVKTK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]