dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|319902459|ref|YP_004162187.1| (Bacteroides helcogenes P 36-108)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Bache_2648 [Bacteroides helcogenes P 36-108]
Sequence length 393
Sequence
MRLDLLKNIIQSSHINFLFGSGLSNPYLSTLGNIETWLTEAEQIEEVDTKNIIKTSLEAY
YFSTVMNPCLYSEISLLNEDRKKHYDSVINNYKSFLSRWNEIMAKRNVSLLDKQVNIFTT
NIDNLVETAAEEVKVEFNDGFKGRITPIFSEDTFSNITSKVSPLYQNQSMIPVFNYMKIH
GSVNWKAIESNDISIDTELKILQEIADLYKCLTPSDVIFDFGDCTNIEDIKKKAEDIIEC
EDYESDKRGQFSDLFSKLVMVRPRKNKFSETVLELHFYELMRLYSNALECSNSLLIVAGF
SFADEHIAKITVRAANSNPTLQILVFAYDDFSKKLIETNINKAGARNNNNILYITPESFK
HSQDADFANKSLKDLTKFDLESINKYVFGYIGI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]