dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|15669045|ref|NP_247849.1| (Methanocaldococcus jannaschii DSM 2661)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MJ_0855 [Methanocaldococcus jannaschii DSM 2661]
Sequence length 228
Sequence
MTNAMKIIEMLRIIDNRAKFMGIKLTMMKNLLEKYKDNKELLKEVLKLTEGTRLHELILE
AYPPLEELKKEIREEEHKIKITSESGGEEKKEFCTFEGPVSLIAYIKEYLRKYYLGNNVK
RIFYDIGKDYAIKLGINTYDDMITFMKKDFGEVVIEKSEPLTVVVKDNKECKNCKASEPI
CYLTAGFIAGCLENMTNKTYIVEVTEEKCQAVGDPYCTFVAKKSIRLD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]