dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|328957311|ref|YP_004374697.1| (Carnobacterium sp. 17-4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribonuclease III [Carnobacterium sp. 17-4]
Sequence length 245
Sequence
MKEHGEIFIERKNTMDDAFLTQLKTKFDLVFHDLSYLEEAFTHSSYVNEHRNLELKDNER
IEFLGDAVLELTVSRFLYELYPNLPEGKLTRLRATIVCEASLSQFAKEYEFDQFIRLGRG
EERMNGRKRPALLCDLFESFIGALYLDQGIDSVLSFLDQTIFPKIKSGAFSHVMDHKTNL
QEFLQQKGEIGIDYQLVDEIGPAHQKAFVVEVLAEGQVLGQGQGKTKKAAEQVAAENALL
ALQEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]