dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|383484156|ref|YP_005393069.1| (Rickettsia parkeri str. Portsmouth)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Putative transcriptional regulator [Rickettsia parkeri str. Portsmouth]
Sequence length 142
Sequence
MQLTSFTDYGLRSLIYLASKPERICSVKEISEYHNISLNHLIKVIHRLAQLGYINSSKGK
GGGIKLAFSPSSMKLGDIIEKLEPNMDIVECFNKNTNSCKITNSCQFKHFIKEASEAFIK
TLNNYTLEDAMITKTIQIKDKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]