dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|328956029|ref|YP_004373362.1| (Coriobacterium glomerans PW2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcriptional antiterminator BglG [Coriobacterium glomerans PW2]
Sequence length 642
Sequence
MRDAEFVRFIRQTKPINPADAAARLHVSARTIRTYVHRANRAMEGFARITLSRESGYAIV
EQDSQRIEAWLSDALRSVETSPQTPQERIAYLLNDLLMRTDWITMDSLCDMLYISRSTLT
GDLKGVERELNRFDLSLLKRPHRGIRVEGEEMARRVCLANIAVESMSGGDLVHGHLLAVV
SRCVENVAHAQRFQIVTTGYQSLLVHIAIALLRIKEGCYVPMASEHLERLRPAREYAVAQ
MIAEGIEREIGIELPQEEIGYMAIHLAGKQTLLDSQGDAQGIVISDDVWGVVSRMLECIW
AAFRFDFRYDLELRMNLARHIVPLAVRLRYSMRLRNPMLPDIRIRYALAFAMAQEASHVL
GAAYGSEPSDDEIGYIALAFALALERQKTEVSKKSILMVCASGAGSARLLEFRCRREFAD
YIDTIATCDVLNLDAVDFSGIDYVFTTVPIERPLPVPVREVSYFLDGQDIVDLRDLLRGD
AVNEALHPFFKKSLFFPHMSTGTKEEALDYLIDRVAEREPVHEDFRNLVWRRERLVATSF
GNGVAMPHPLEPAAETTIVCIGLLDEPVAWDDSGCDVRAIFLVAFAPDVDDSLKSFLSVF
TDILSSARDIDLLVQHQSWKTFADIVASAFASARAPAPTERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]