dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LjSGA_032363.1 (Lotus japonicus )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment + phase: 1 /pseudo/partial
Sequence length 262
Sequence
SVLNVRLKASVKLHFIRIGLIXWLSIQFASRQINHCIRCYCLMETCLNKVTXRMASIILF
GRTPSRNLVICLPWLLGNCRAEMTLSLPVPDGKCPLGSGHLQMTYLRLHMLCILXKQLXS
GMKMFLGLNMTWISSMLLLSQILTWELWKIRAXTYVSFLSACLGWLYIFNSKLVLASPET
ATDADYAAILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSADLGSRTVKRI
ADVSKLEITSFHRLLIFAFFFH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]