dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LjT09K03.110.nd (Lotus japonicus )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment + phase: 0
Sequence length 375
Sequence
MASSGSNELTGTNTLQSIRYNRGSLQLLDQRKLPLETIYLEIRDSTDGWNAIRDMVVRGA
PAIAIAAALALAVEVSNLGDFSGSPSDAASFLQNKLEYLVSSRPTAVNLSDAATKLKEVI
SGAAATASEAKSVFQDYIEAAEIMLVDDVASNRAIGSYGATFIQHQVEKPKLSVLTHCNT
GSLATAGYGTALGVIRALHSGGALERAYCTETRPFNQGSRLTAFELVHDKIPAALIADSA
AAALMKSGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNVPFYVAAPLTSIDLSLS
SGEEIVIEERSPKELLNSRGGLGEQVAASGISVWNPAFDVTPANIISGIITEKGVITKSS
AADAFDIKAFIQKTL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]