dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|206900235|ref|YP_002251022.1| (Dictyoglomus thermophilum H-6-12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanyl-tRNA synthetase, beta subunit [Dictyoglomus thermophilum H-6-12]
Sequence length 799
Sequence
MLVSYRWLMDYLEEEIPVKEVINALRNLGLYGTIQKSIGANWDKIIIGEIKSIEKHPHSE
NLLICKVDVGEKLLNIVTGAKNVFVGAKVPVALPGVEILGEVIGIREFNGIKSEGMLCSE
YELEFSEDKEGIMILPEDFKIGSTFDTYFGKGDFLIDVEVPSNRGDCLSYLGIAREISGY
FGVPLKFEFKKAQEKDDISIKDFASCEVLDFDLCPRFTLRFIKDVKIGPSPLWLRWRLER
VGLRSINNVVDITNFIMLETGQPLHAYDFDLLKGGKLIVRRAKEGEKIVLINGEEKILDN
DILVIADAERAVGIGGIMGGKDTEINDNTKNVLLEAAYFSPVNIRRSARKLGIRTDASLR
FERNVDIHRTADILDYAAEMIRLVAGGDIAKDKIDINKGLPSLTKVFLRPERVNKILGTN
LKEDEIVRILSKIGFDIKSRNPVLEIEVPSYRQDIKEEIDLIEEVARFYGYNNIPSVPLQ
KGHIVDPPLTEEIIERRIRETLPSLGLYEAINYSFMSVKDLEKAGILNTEPFNLFIQISN
PLSEENSVLRTSLLPSLLNVAQVNSNRQQKDVFVYEIGKVFYKGKDEYIEEKHLGILMTG
EAYKDPWSVPYEIRKVDFYDLKGIVETIFERIWKEEPTFKKSNFEFMHPSKQSYIAFRDE
IVGFMGEVNPWITQNLDIRERVYFAEINLDKLNFESPKPKYKPLPIYPGIRRDLALIIPE
DMPVENVEKDILETSGELLKWLRIFDLYQGEKIEKGYKSITFSLFFLAEDHTLEDKEVDE
IINKVLIKLSEKGVYLRQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]