dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|320105524|ref|YP_004181114.1| (Terriglobus saanensis SP1PR4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment regulatory protein MerR [Terriglobus saanensis SP1PR4]
Sequence length 242
Sequence
MWIPGSLGREPNGGGQSCRSSFPAFTCPLSEAPLIAGPFFRRELEKKLDGDGNRENYIQP
ILRRLILARIGPSLAPSFRMTPSSPIRQIGKSEIPDKLYFRIGEVARLCEVPPYVLRFWE
SEFPQLKPNKGGTGQRLYRRKDAEMAMRIKRLLYDEGYTIPGARQVFKSEVKQKEPELFR
MEPSQAVPKTDLSSLRKSLQEIADLLSRPSPGTVGQSRRARIIPSTRQTKVMDRKPELPP
LF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]