dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|320107508|ref|YP_004183098.1| (Terriglobus saanensis SP1PR4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment excisionase family DNA-binding domain-containing protein [Terriglobus saanensis SP1PR4]
Sequence length 70
Sequence
MSPLGETPAKFLTAEEAAVHLGCLNSRTVSRWAREGYLPAYALGEGKRRLWRFLLTDLDA
WMRARRTVTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]