dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|320108931|ref|YP_004184521.1| (Terriglobus saanensis SP1PR4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment excisionase family DNA-binding domain-containing protein [Terriglobus saanensis SP1PR4]
Sequence length 75
Sequence
MLYQESNELVSNRGIVRRLLNVGETALYLGVKVDTVYKWSRMGVLSKVKLGGALRFDVNV
LDRFIEQHSTKTIDY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]