dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|325290454|ref|YP_004266635.1| (Syntrophobotulus glycolicus DSM 8271)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methylenetetrahydrofolate reductase [Syntrophobotulus glycolicus DSM 8271]
Sequence length 247
Sequence
MNKIAVELVPRDERSLISELSLINSRFPLIKTINFPDLLRFDLRSWEGCRIAQRYFQDVI
PHIRAMDIKLSDELPMQGFLIEHKINQVLVVTGDLPQDMTKKIYPSTSIEVIKKFKREMP
GIKVYAAVDPYRKSVREELEYIRRKLEAGADGFFTQPFFDLRLMEIYAEILDGCEVFWGI
SPVTGEKSVNYWETKNNVVFPRGFEPTLKWNVNFAKQALALTESRKDNIYFMPIRTGLEE
YLRGIFG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]