dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|332299823|ref|YP_004441744.1| (Porphyromonas asaccharolytica DSM 20707)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA mismatch repair protein mutS [Porphyromonas asaccharolytica DSM 20707]
Sequence length 874
Sequence
MAKKEIAETPMMRQYLQFKKKHPDAILLFRVGDFYETFSDDAIEASKILGITLTKRANGA
AQHVELAGFPHHALDTYLPKLVRAGKRVAICDQLEDPKLTNKLVKRGITEIVTPGVVTTD
NVLQSKQNNFLAAVYPQAKGENRYGLALLDLSTGEFYASECTDQVLAKLVSGYNPKEILI
ERKHRDHLQRLLQPEGHLSDYDDWIFSESNNRERLLQHFGTLSLKGFGIDTLPLAITAAG
AVLHYLDMTKHTEIGHITRIVRIDEQRHVRIDGFTAHSLELTTPMNAGGTTLRQILDQTV
TPMGARLLDQWIAFPLKELQAIQQRQSIVANLVDNPQLRTQLTDQMKEIGDLQRLVGRVA
MGRITPREVVRLGLSITLIAPIRQLALDEGEETLTALCSLLDPCAQLCQQITFQLNPEAP
QQIGKGETIAEGFCEELDQLRRLLKSGKQYLDDLLARETEHTGISSLKIGFNNVFGYYLE
VRNTYKEQVPEEWIRKQTLVSAERYITQELKEYEEKILGAEDRILALEQELFAKLIGTLQ
QFANQLLQDAQILAQLDVLASLAAVAKAYDYCRPTLNEGYDLEIVDGRHPVIERTLPAGQ
PYIPNDVRLSPIDCQIMIITGPNMSGKSALLRQTALIVIMAQMGSFVPATSATIGIVDSV
YTRVGASDNIAVGESTFMVEMQEAASILNNLTPRSLILFDELGRGTSTFDGVSIAWAIVE
YLHSTTQGRAKTLFATHYHELNELADHLERVQCYNVSAREIDGEMLFLRKLVPGGSAHSF
GIQVAKLAGMPTWIVARAGEVLQHLEAYRTESDQAPDSATPSTSQSGGMQMSIFQLDDPV
LTAVRTKINELDINNLTPLDALKQLDALKQMLNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]