dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Thhalv10000111m|PACid:20208496 (Thellungiella halophila v173)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 549
Sequence
MANKHFFKPLLPGFHSHLTIPVAFFLKYIKGTNEQKKTTAKLRSDASDITWEVKIEDGQK
LTDGWKEFVLAHDLRVGDIAIFRQEKDMAFHVTLMGPSCCEIQYESGLDDENNLGKIPKK
TKVKKNPRKETESSSLDPSCFVAHVTHASLRYDSLNLPMSFARANGLNTRCGEIVLMNDK
GRSWTLALKQKKCGSTYIRRGWRTFCSANGFKAGEAFTFKLIQRGKVPVLRLSTTESEEE
EESSGADEVESLSTEPESDEESNLAEIQRRKKLKKNPERETESYPLDPSYFVAKVSPSTL
RQDRLYLPRNFSRENGLDTRCGEIVLMNEMGRSWTLNLKRKNSCGTAYIRRGWRSFCRAN
GLRAGDSITFKLIQRGGTLVLRLSPTDSEEEEEEEEEEEEEESSEGDEIESLSTEQESDE
EGNQDEKSFKKPRLLWKASSTPSQNRFVTLTLKPFNLTKYVMLLPIPFTRMHGINEETKM
SLVDKHGVRWSTNLRSEITGDRIRMVGGWQEFFKANCVKIGESVMLKLIWEGDKSCVLKF
CSKLKQVTK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]