dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|384052869|ref|YP_005485963.1| (Acetobacter pasteurianus IFO 3283-07)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 5,10-methylenetetrahydrofolate reductase [Acetobacter pasteurianus IFO 3283-07]
Sequence length 249
Sequence
MSLSRLSVELIPRSAEALAADVATVKAAFPAADTLNIPDLMRFPLRSWDAAALVRPQFGN
VIPHIRAIDIAPDAPLPGADQPGLEEILVVHGDPPADLSHRTYPNSTESIIRRYRREAPH
LKVYAAFDPYRRAPWKELEDVARKKEAGAIGFFTQPVFDLKLFDLCREWMQGECVFWGLS
PVIGPKSRSYWETTNHIVFPRDFSPTLDANIQFAQTVLKELAQEKGKAYLMPVRIKLEQY
LPALLDAVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]