dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|218236054|ref|YP_002369989.1| (Bacillus cereus B4264)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PTS system cellobiose-specific transporter subunit IIA [Bacillus cereus B4264]
Sequence length 83
Sequence
MEAIDCAKRGEFTEAEAKLQEALEELKEAHRVQTELIQKEAGGEKTEVTLLMVHAQDHLM
NAITVKELASEFVELYRKMSVDE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]