dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|184153799|ref|YP_001842140.1| (Lactobacillus reuteri JCM 1112)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment penicillin binding protein 2B [Lactobacillus reuteri JCM 1112]
Sequence length 685
Sequence
MNLFGSRTKKRQNAQSIIPFRLNMLLWIVGILLLALTIRLFYLQVLQGTSFKAEVKRSDT
TTQTNNVQRGMIYDSQGNVLVGNQTHQAITYTKGANVTTDQLYQIANRLGKYVSVSNKNS
RLTDRNEEDYYLADKERLKSVLKHVKTSDADSEDTKYDKALEYLSKHPDSWELTDQQKNN
ARIYAAMSGAYSLSTTYIKETGVSAKELAAVGEHLNEMPGVKIGTSWTRNYPQGTDIQSL
TGTVSTTGLPSDEVNSLLAQGYSRNDSVGQSYLEKQFQSTLAGSKSQTEVTTDGNDVTKE
KTKYPGKKGDNLVLTINSKFQKQVQSILKNNYSAAGNQYSTGVYAVVMNPNTGAIYAMAG
IDRNPETGKETPDEIGAINHPITMGSVVKPAMVMGALMDGVITPTNNTLTDMPIKLAGTS
SKGSWFNHGGSANMAINAATALEVSSNSYMMQLLMKEAGMKYTPNAQITMKPSIFAKARG
YFNMFGLGVKTGIDLPGETSGYTGPADQKHIGSALDLSYGNYDGYTLIQLAQYMSTIANG
GNRMRPYIVKEIRGTKANGQLGAVEYTTKPQVQLTIPASKADFDVVKQGLYQVVHGSNRY
VTGKPLASVKPSVSGKTGTAETYYKSHSTTTLSFAGFAPSDNPQVVVALAIPGASNSDGG
ANLTMAKQIFEAYWKTVQSPKGFGD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]