dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|478693498|ref|YP_007750405.1| (Rickettsia prowazekii str. Breinl)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NFS1 nitrogen fixation 1 isoform CRA_b [Rickettsia prowazekii str. Breinl]
Sequence length 255
Sequence
MAVNNEIGVIQPLKEIGKICRERNVFFHSDIAQGFGKIPINVNECNIDLASISGHKIYGP
KGIGALYIRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGIASEIAYNEMEKDTQHV
NYLFDRFLNNIHSKISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACT
SASLEPSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLVCSKIDKLRRLSPLWEM
MQEGVDLKKIRWTAH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]