dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|327310833|ref|YP_004337730.1| (Thermoproteus uzoniensis 768-20)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase C14, caspase catalytic subunit p20 [Thermoproteus uzoniensis 768-20]
Sequence length 800
Sequence
MRAGLVALVVLLLISLVVNAQQITTLGIRVSMPAPLPSQQFPAAIVDFTGMVRHELYLND
MFYITFDLTQYQGTYFVVIKQIGGPGSPAEVAYGDVQGGYIYGYPMEIVQPIYEGQTYTF
EIDLYNQNGAFVGSATVSYVEKWCPDVTIDGVQLTPSTPVGGGNVQVAVTLTNDGEESWR
YHVSVYSQGGALTKTSQDVTIGAGSTTTVTLTVPVSATYTATTDTMVVDVSCDNGAWHFT
RSYQINIMPARPGPFVISAPTVQARLGQPVTFTLSLTNQGSDAQPISLTFSTGSASFNLP
STLPGGTTTNVPVTFTPTMPGVYKVTVTLTYKSPITGQTYQDTGSFTVEVYAELAVNAVD
QNGNPVQITPNIAGNNTSVAWLLPGTYTVSVPQIVDLGGGARLVFVGWQGGGTSPSTTVT
LNGNTQLTAVYKEQYQVVLDLSPALSSQTYWVDAGSSFTPQAPSHVDITQDSRWALEGFQ
VAGQQIGPGQAITVTGPLTIKAVWVKEYKITVSCGQVACINGQSQYVQWAQEGSTLSITL
AQIVNVNSRTRWVLSGSPTISFTVTGPQTITPNYVEEYYVNFGYAVKTASGISSTTVVTG
AWIESGNTVTIPTNQLEPPGGPGVKYVFSGYLVGNTPISGPQSGQTITVTGPVDVYAVWD
KYYYLNVTTPVGTAQGGGWYLADSYATVSVGQTTYGFLVYQRFVKWVASDGSVYTDPTIT
IKVDKPLTLTAVWAQDFTQAAILGGGLAAAGTAFWKRDFITRTLSRTFMKTRSKTRVELE
DVDKTHTWVAGEKKESNDNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]