dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PDK_20s1382061g001 (Phoenix dactylifera )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment [locus_tag="PDK_20s1382061L001"] [product="similar to predicted protein"] [strand="+"]
Sequence length 378
Sequence
MVGDFNYIQGPSEKRGDRAFTKLVMREFRNFLSRNGLIDLGFSGLHFTWARDARALKDVL
ADYCAVSGQRVNFQKLAISFNPSTERRVTREIRRILEMQEEEGTWSYLGVLIIGRRLWVT
ECSDLSFLWGSHGGGHGATESACLSVRMALGCSPSRRGTDETGDENFWQWNRLGLKKRSN
FRLQLLVPFALMQKMRISSSDLANLPQEEYTVEGSAFHWFWILHQFGFFADNLCITDECA
FLCQNSSSPSKLLQARSCTKELSSEHLPSIQNVAASTNKEIDSHIPNYPSLPPQLICQLH
NVTMHADVETDEVYAQMTLQPLSPQEQKEPYLPTELGTPSKQPTNYFCKTLTASDTSTHG
GFSVPRRAAEKVFPPLEI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]