dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|313127116|ref|YP_004037386.1| (Halogeometricum borinquense DSM 11551)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aminopeptidase [Halogeometricum borinquense DSM 11551]
Sequence length 435
Sequence
MTDWIGKTFTSDFGWDHLESLVDIGDRMAGSPGEREAMELTRDALEAAGARNAHIDTFEI
QGWERGDSRVVTDGTTQDCIALPRSPSDASSGEFVDLGYGLPEDFEADLSGKVVMVSSTV
PDHYERFIHRREKYYHAVEAGAEAFVFANHVEGCLPPTGSVGTEESPVGDIPAVGVSKEV
GTRLARRFEGEAVTVEVDCETPPAESGNVHAELGPDTEDELLVTSHLDAHDIAEGAWDNG
SGTAMVVELARILAEREDELETRVRFIAFGAEEVGLVGSGHESDRLGDEREHIKAVVNND
GVVFGRTLKFDTHGFDALEAAAESVGDQFDHPVSIVPELVPHSDHWPFTQWGVPGYMISC
ETAGRGRGWGHTFADTLDKLEVRNLREQAILLAQLVVDLADDEMEIQHKDEAEIIEALEE
EDHAAGMKITGDWPY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]