dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|330835158|ref|YP_004409886.1| (Metallosphaera cuprina Ar-4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment band 7 protein [Metallosphaera cuprina Ar-4]
Sequence length 291
Sequence
MSLQFRGQVISTEREDGTSLMAPDVLIFRYPKEQITSKSLFIVQPTENCVVVIQGQVQAV
LPPGTHNIQSPQNPLSSFMSRFRYNQLPFDTVALFVSTTRHEVRIQGKSQTDDLVPLDYE
VAVYYRITDPSKLVINVQFAGAFFKDGELASYLSPIIDQEVSSILNQVKLVDVYKKFGDI
SVAVTGALKQFLAELGVELISVRVTRLIPEDPELRRIIQLRDLGLEVEKAVRMGLARVLT
EQGNPASVNMAIGTPYYPNLTTLVNLPQRLLQFSMGGKEVEKDEQDQPKGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]