dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479172567|ref|YP_007800754.1| (Faecalibacterium prausnitzii)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain [Faecalibacterium prausnitzii SL3/3]
Sequence length 478
Sequence
MDTAILARVEDFCIREGLLQPGTPLQLAAAVSGGADSMALLLLLRQLQPRFGYTLSACHV
NHGLRGQSADRDEAFVRAECARLGVPLRVFHAAELTPPPAHAGEDWARRLRYTAFVQLQG
QGIDAIATAHTANDQAETLLLRLARGTGLHGAGGIRPRRGCYLRPLLCLSRAETEAVCRA
AGQTWVTDETNDTDAYARNRLRHSALPALKSTNAAAVQNLARFCEKAARADAYLAAGAAK
LLAAARLPGAEPAWQLLPLQAADPLLLETALHSLVAPVRDAEEKYVQLLCAVVRQGSGAV
QLTGQVRFCAGNGCLRQEMLPDALPRQLESAPQQVPLLPEKQPEFRLRGGWKGKAELLTA
DFEKKIQVVHKKDLKNRADYARITTLYTGLVLRARQPGDRFRPAGRGLSKPLRKWMNEAG
VPNELRDTLPLLASGSEILWVCGEGFADGLAPDTESRWILHLNAEIETQEEKTNEYAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]