dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|326402450|ref|YP_004282531.1| (Acidiphilium multivorum AIU301)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment succinate-semialdehyde dehydrogenase [Acidiphilium multivorum AIU301]
Sequence length 492
Sequence
MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGELVGRVPAMGAAETRRA
IEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAEQGKPLAEAKGEIAYAA
GFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPWNFPSAMITRKAGPGWAA
GCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGPMGAELTANPIVRKFSFTG
STEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAVKGVIDSKFRNAGQTCVCAN
RILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLINREAVEKVEAHIADAVAGGAR
IVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVAPLFRFNTEAEAIAMANDTEFG
LASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAPFGGVKSSGLGREGSKYGIEDYL
EIKYLALGGLGG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]