dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428202080|ref|YP_007080669.1| (Pleurocapsa minor Pleurocapsa sp. PCC 7327)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ADP-ribosylglycohydrolase [Pleurocapsa sp. PCC 7327]
Sequence length 314
Sequence
MRYSLLSRFQGGLLGGFLGEILIGSSSKREGMIVSEIGIDSIEPWLASGTLSAEDWEQIG
ARLSTTLEGKTPTNGGELAVAALPILFFFHDDLGLLKEQLQHLVNIWQLSAQTLEDVLIW
AYAIALALREKLDPDRLLSQILARYRLAQTPLMDQLEQVRTWLEQGTSLRQAIAQISKGG
KPNPIVLALYCFARTPEDFRLCLMQAIRTGKQASLVAALTGALAGAHNSFSGIPIDWRVA
VGKHPTGQKLTREVTCLFAAWSGAYRLEGLDTLESAAVTSPLVMQPRSSLKIISQGEYSF
LDPLFNVDSKVIKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]