dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|431801501|ref|YP_007228404.1| (Pseudomonas putida HB3267)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cytochrome B561 [Pseudomonas putida HB3267]
Sequence length 181
Sequence
MVSSTPATHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSVERNLMKDLHFMLGLSVF
VLVWLRLAIRLSRPTPPIVPKPAAWQTGLAHLMHLALYLLMIILPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]