dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|344200622|ref|YP_004784948.1| (Acidithiobacillus ferrivorans SS3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanyl-tRNA synthetase beta chain [Acidithiobacillus ferrivorans SS3]
Sequence length 799
Sequence
MRVSIQWLRELLDTSWDTEEIAQRLTMGGIEVEVVEDAAPAFHGVVVAAIQSVVCHPEAD
KLRVAQVDVGDGRLRTIVCGADNLAVGQRVPLAMPGAGLPGDRDIVIAALRGIASEGMLC
AAAELGLDDGSSGLLILDADAPIGADLRDYLGLDDQVLTLGITPNRGDALSVLGVARDLC
ALGAGTLRNPLEPMAKCSWVTSGPEEGSSTPDDFPVHIATAAQSACPSYTALWIDGVPQR
LPDRLHERLRRAGQRCIHPVVDLLNLHMLETGQPLHAFDAETLQGGLSIRWAQDGEILDA
LDGRDLPLASDMLVIADRAGPVALAGVIGGRRTAVSAQTHSIVLESAFFQPKVIQGRARR
LGLQTDAAMRFERGVDFALAPRVAAAVLTRLAILGKADLRATRSHTVLGQLPEHAPITLR
RARLARILGMDYEDTVVETALTRLGLRVSEIPDGWQAISPSHRFDLHIEADLIEEVGRIY
GYERLPAHRPVGTLQPLAMARGPQPTTLRGILQARDYHEVITYSFISRQAQDVFTPDADA
PALLNPLSTDLAVMRASLWPGLMQALQFNVKRQQDRVRIFELGRVFSANDQHLVLGGCMV
GAADRESWAQPQRAADFYDLKGDVSALLTLWPQTEFSFRPLANHPALHPGQAAEIWVADQ
RVGMLGALHPTLAAECDLDKSPFFFYLDIECLDGLVNVSRFTPLSPFPALRRDMALVIPD
DILAGTVLNVMRLSASGMVKEITIFDRYQGASLMVGTYSLAFALLLQDAERTLTDADVQA
EMDRLLVAVQRLGSIGLRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]