dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|404490014|ref|YP_006714120.1| (Bacillus licheniformis DSM 13 = ATCC 14580)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment endoribonuclease [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence length 127
Sequence
MNKVESIFEAGNLKSNGHYALAVIHQNTVYVSGQFAIDPITQEKKFGTIEEETLQVLSNI
EYILKKAGSHKGKILKITLYLHDINLLDRVDNVCQGFFHDYRPARSVVSTTELHYGFQVE
IEAIASL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]