dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSLAFP00000003551 (Loxodonta africana 76_3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection supercontig:loxAfr3:scaffold_13:10925073:10945228:-1 gene:ENSLAFG00000004257 transcript:ENSLAFT00000004259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 788
Sequence
MNQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGKKLRDAFRCSSAKIKTVVFGLFPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMEAARLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFVRGFMTAAGLQILISVLKYVFGLTVPSYAGPGAIVFT
FIDICKNLPNTNMASLIFALISGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLSPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKNKLDCCVWVVSFLASFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGCALAQVMDTDIYVNPKTYNRVRETAGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLKKQEMGRKMPTQHKKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQKPTNGASVSYITFSPDTSSGAHCELPASAESPSDTLASVPPFVTFH
TLILDMSGVSFVDLMGIKALAKLGSTFGKIGVKVFLVNIHAQVYNDISHGGVFEDGGLER
SHIFPSIHDAVLFAQAGTRDVAPGHSFQGAPVDPELSLYDLEEDSPSYWNLEQEMFGSMF
HTETLTAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]