dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSLAFP00000026656 (Loxodonta africana 76_3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection supercontig:loxAfr3:scaffold_16:13756173:13773115:-1 gene:ENSLAFG00000026653 transcript:ENSLAFT00000032420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 423
Sequence
MKWKILPIYLLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDAACNCDYNCQYYMECCPDF
KKVCTVELSCKGRCFESFRRGRECDCDSECKKFGKCCPDYNSFCEKVKNNKKKKTPKKRP
APELPVVEEAGSGLDTKEIQSIDSLVRPHQGISVNLMFSDETNLCNGIPVDGLTTLRNGT
LVAFRGHYFWMLSPFRPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTN
DIKDAGYPKQIVKGFGGLNGKIVAALSIARYKNRPESVYFFKRGGSVQQYTYKQEPVQKC
TGRRPAINYPVYREMIQIRRRRFERAIGPSQTHTIRIHYSPVRVTYQDKDFLHNEVPVST
LWRGLPAVVTSAISLPNIRKPDGYDYYTFSKDQYYNIDVPSRTARAITTRSGQTLSKVWY
NCP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]