dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|94986820|ref|YP_594753.1| (Lawsonia intracellularis PHE/MN1-00)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment membrane proteins related to metalloendopeptidases [Lawsonia intracellularis PHE/MN1-00]
Sequence length 437
Sequence
MSKTKLLVITIGIASIILAAATYIFFKNTDPPIISMIQPTQYISPRQPLTLTITSKYSPL
KLIQIIVKQNEYTKTLINQPIINGHLIETVDIDFKKSGLQDGPFELIVKAQDSSYSNFGK
GNISNKTWDMNFDSQPPQITIHSPTPSLHKGSATAIAFTVSKPVAVIGVQLEEKFFPAFQ
QANGTYYCFFPFPIEFSPKTFNPKLFAQDLAGNKSYISVHVHSLERSFKIDTLTITDTFL
DKKMPNFEQNFPDTQTQVERYIKVNSILRIENEKKLIEISKKTSPMMLWSGKFHTLPRAA
VKATFGENRTYMYQNQKIDQQFHMGLDLASTANAPIPAANDGIVVYTGDLGIYGNIVIID
HGLGLQTLYSHLSKITAKEGDVVKKGDLIGYTGMTGLAGGDHLHFGFLVGGIQVNPIDWL
DPKWIKNTIITRLNNNV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]