dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|81429211|ref|YP_396212.1| (Lactobacillus sakei subsp. sakei 23K)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATPase [Lactobacillus sakei subsp. sakei 23K]
Sequence length 459
Sequence
MLERAFQNEIRCHQFWPTGAKVIVATSTGVDSMVLLTLLQRLPTALKPQLIVAHVNHELR
TESVAEEAYLRQFCLENDLSLQVAHWPLQQHPQTGIEAAAREFRYQFFEHLMTAEKADYL
VTAHHGDDQLETLMMKFIRSGELHEMRGIQSQRPFADGTLIRPLLPFAKQDLRDYALANN
ITSFEDQTNYETTVLRNRVRHTLVPFLKQENGQILQNANRFSQQLTALLGQQAQLATTLL
PLLDLKVTDKVISGQLKAIKTLPTAQQTAIWQLIIKQHFPQISPLKETQLQQLKQLIQST
VKPQGQLALGQRILFTKIYDRFQIGETTIGEIAAKDEKIRILMLNKWCVLPNNEQIGIFE
INHLPRKLSGQQLIWLADEQWPIVAKPCQLTDAIMIDKTHHKTLKRLFIDLKVPQEKRLN
SWGIWSQETLIGHPEFRVSALFIHEQTGKIRYVLCYANE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]