dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|71277901|ref|YP_271586.1| (Colwellia psychrerythraea 34H)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment nitrite reductase [NAD(P)H], large subunit [Colwellia psychrerythraea 34H]
Sequence length 866
Sequence
MNTDKQLLTKTNIVVVGNGMVGHHFVEEMAKNPNYQITVLSAESRLAYDRVHLSEYFGGK
TADDLAMTTPEHYEALGVTFKTNAKVILIDKIVQYVTTESGETYHYDKLILATGSYPFVP
PIPGKDQDHCLVYRTIDDLEDIAASAKESKVGVVIGGGLLGLEAANAIKQLGLQTHVVEF
APQLMGVQIDGGGGRLLRQKIEDLGVQVHTSKATSVIEKGNTSRYKLCFSDETELETDLI
LFSAGIRPYDNLAREFDLTLGERGGIVVNNQCQTSDENIYAIGECALWNNFIFGLVAPGY
AMAKVVAKHIAGFTNEGNGENGEIAEFTGADMSTKLKLMGVEVGSIGDAHGKTEGALTYT
YENQPEGVYKKIVVSSDKKSLLGAVLIGDTSEYDTLLQYMLNAIELPESPEGLILPMAAD
KPTLGVDALPDTATICSCHNVTKGDIIASIDAGAMTVGDVKSCTKAGSGCGGCAALVKSV
ADNEFEKRGVEVKKDICEHFAYSRQEIYDIVSVGKIKTFDELLEKHGRGLGCEICKPVAG
SVLASVWNDYILKKPHLSLQDTNDTYLGNMQKDGTYSVVPRIAGGEITPDKLIVLGEVAK
KYNLYTKITGGARVDLFGARVEQLPPIWKELVDAGFETGHAYGKSLRTVKSCVGSTWCRY
GVQDSMSMAIDLEHRYKGLRAPHKIKFGVSGCTRECAEAQGKDIGIIATDNGWNLYVAGN
GGMKPRHGDLFATDLDDETLVKYVDRILMFYVQTGDRLQRTSTWIDNLEGGLAYLQDVII
NDSLGLNDALETQMKAIVGTYQCEWKTTIEDPEALKRFQPFVNSDKSDSNIQFVTEREQI
RPARGQEKIDVKFIDATEKEAVAEEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]