dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|71281261|ref|YP_266863.1| (Colwellia psychrerythraea 34H)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein CPS_0095 [Colwellia psychrerythraea 34H]
Sequence length 470
Sequence
MMKQHLDALKDSKYCPLWHDQDIRPETLPALSADTSCELLIVGGGFTGLWGALQAKERQP
DADIILIEKTTISDGASGRNGGFLSSSLAHGETNTDHQFPGEADKLHQLGQQNLKEFIET
LEHYNIDARYEKVGETSVATDQASVDALRATYESEKAQGEDVVWFNQEEMQAQVNSPTYL
AGLWYRGGQDGVVDPARLCWGLKRVILELGVRIYEETPLTSLKKLGQDKMEVTCSDVKII
SDKVLMATNAYRNPIGQARRSIIPVWDYQIATQPLSQEQLDSIGWHKSRHALSNHANMFH
YYRFTKDNRITWGGGGAVRYYFNNGIDQSYADIPERFAQLSEEFFETFPQLKGIKFTHRW
SGIIATSTRFCVVPGVAYDGRVAWAIGYTGLGVGASRFGARIGIELLGYKPSEILDMQFV
KKKPIPWAPEPLRWIGVYLTHKALEKADANGGKRGLWLKLLDMLNLGFTC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]