dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|88604259|ref|YP_504437.1| (Methanospirillum hungatei JF-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sugar isomerase (SIS) [Methanospirillum hungatei JF-1]
Sequence length 194
Sequence
MSMMISRIGEIAETLRQDQVDCFISALMSADRIFVIGAGRSGFVAKSFAMRLMHLGLTSY
VVGETVTPSFHKNDTLIAFSGSGKTKSVMEACETTRQIGGQICLITGTRVSPMAELADCV
VLLDTEEESCHVGPDHFDLRQLRGEHRSISAACTPLGTLFETTAMIFADSVISALIEMKH
CSIEEIMHRYTNMQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]